PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00029149-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 153aa    MW: 17137.7 Da    PI: 10.5241
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00029149-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.83.4e-1555100148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       r ++T++E+  ++ +++ lG++ W+tIa+ ++ gRt++++k++w ++l
  PSME_00029149-RA  55 RSSFTQQEERSIIMLHAILGNK-WSTIASLLP-GRTDNEIKNFWSTHL 100
                       679*******************.*********.***********9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.3E-1940109IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.2E-64262IPR009057Homeodomain-like
PROSITE profilePS5129422.66850104IPR017930Myb domain
SMARTSM007171.8E-1354102IPR001005SANT/Myb domain
PfamPF002493.2E-1355100IPR001005SANT/Myb domain
CDDcd001677.37E-1057100No hitNo description
Gene3DG3DSA:1.10.10.604.9E-2063101IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
FSVATLGKGP CCKETGLKEG SLDSTARGIG VLFPSLLWEK LSLRWTNYLN PDIKRSSFTQ  60
QEERSIIMLH AILGNKWSTI ASLLPGRTDN EIKNFWSTHL KKRLLKMGLD TSTHAPIAES  120
NPSVPQWSEA LALMRHTARS RSSALERITA YVR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-204410448108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015695646.16e-40PREDICTED: transcription factor MYB39-like
RefseqXP_002444838.15e-39hypothetical protein SORBIDRAFT_07g028990
SwissprotQ9SPG58e-34MYB76_ARATH; Transcription factor MYB76
TrEMBLA0A0D9WNE23e-39A0A0D9WNE2_9ORYZ; Uncharacterized protein
TrEMBLK9LVX99e-40K9LVX9_9ASPA; R2R3 MYB
STRINGSb07g028990.12e-38(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.22e-40myb domain protein 16